PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G007962.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 111aa    MW: 12421.3 Da    PI: 7.8642
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G007962.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.41.8e-3671061100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +C +Ck+lrrkC+++C++apyf  eqp+kfanvhk+F asn  kll++l +++reda++sl+ye ++++rd vyG+vgvi+ lq+ql+q
  HL.SW.v1.0.G007962.1   7 PCTGCKLLRRKCQPECMFAPYFLPEQPQKFANVHKVFEASNAAKLLNELAPSHREDAVNSLAYEVDMQLRDLVYGCVGVITLLQHQLRQ 95 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ +l+++k+e
  HL.SW.v1.0.G007962.1  96 LQMDLSSTKSE 106
                           ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.3286107IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-367104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MASSNSPCTG CKLLRRKCQP ECMFAPYFLP EQPQKFANVH KVFEASNAAK LLNELAPSHR  60
EDAVNSLAYE VDMQLRDLVY GCVGVITLLQ HQLRQLQMDL SSTKSELSKY *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.11e-60PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.11e-60PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.11e-60PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.11e-60PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG35e-55LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLD7SSJ32e-60D7SSJ3_VITVI; Putative uncharacterized protein
STRINGVIT_00s0340g00090.t014e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96253043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.43e-55LBD family protein